The xylanase produced by strain L10608 has good hydrolysis properties when hydrolyzed substrate of xylan. The xylanase gene（xyn-GH10 and xyn-GH11） of L10608 was obtained by nested PCR. The xylanase gene （xyn-GH10 and xyn-GH11） was obtained by nested PCR， then the bioinformatics analysis was performed. The xyn-GH10 has a total length of 1 469 bp， molecular weight： 50.677 ku； theoretical pI： 7.98； It predicted that the xylanase signal peptide is MGIQALPRAAVRQKLRTPLPALAAGVLGLTAALVPPTNADA by Signal4.0； the xylanase protein sequence has distinct family 10 glycoside hydrolase sarcina barrel conserved region catalysis domain， and encoded a non-catalytic section RicinB-lectin domain consists of 108 amino acids. xyn-GH11 full length is 729 bp； molecular weight： 24.003 ku； theoretical pI： 8.98； It predicted that the xylanase signal peptide is MHQDGSQQDRTQNPAPFGGLSRRGFLVGGTGAAALAAGSGLLLPGTAHAA by signal 4.0. The xylanase protein sequence has a distinct “right-hand” conserved region of the family 11 of glycoside hydrolases. The xyn-GH10 activity was 160 U/mL， and the activity of xyl-GH11 was 55 U/mL.